Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella ovis Cobalamin synthase (cobS)

This Recombinant Brucella ovis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A5VQ44

Expression Region

1-260

Origin

Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRNGLIGDTIRSLGFLSRLPLPQGWFDNTDDSLPRNARAFPLAGGILGLLAGVALLIAN AISLPPLAAALIAIGALAAMTGALHEDGLGDTADGFFGASTPDRRLDIMKDSRIGTFAAL TLVIWTSVKASLLMAIIARAGAGYALLALIGTEAASRAGMLAFWHALPSARPGGLADSMG QPQWETVVCGCGLGLALLAIGFLPSGGMVALINALVLMTVVLFGFARLCMAKIGGQTGDT LGAAQQIGSLAALIGLVMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Olfactory receptor 10C1 (OR10C1) ELISA Kit
GTR10318981 96 Well

Human Olfactory receptor 10C1 (OR10C1) ELISA Kit

Sign In for Pricing
View Details
Biotin Mouse IgM, κ Isotype Control
JOT22335F 25μg

Biotin Mouse IgM, κ Isotype Control

Sign In for Pricing
View Details
SMAD1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
44392064 1.0 µg DNA

SMAD1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
FCGR3A Antibody - middle region : HRP (ARP63559_P050-HRP)
ARP63559_P050-HRP 100 µL

FCGR3A Antibody - middle region : HRP (ARP63559_P050-HRP)

Sign In for Pricing
View Details
PYROXD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV664552 1.0 µg DNA

PYROXD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
UBE3B antibody
MBS839805-01 0.1 mL

UBE3B antibody

Sign In for Pricing
View Details