Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella ovis Cobalamin synthase (cobS)

This Recombinant Brucella ovis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A5VQ44

Expression Region

1-260

Origin

Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRNGLIGDTIRSLGFLSRLPLPQGWFDNTDDSLPRNARAFPLAGGILGLLAGVALLIAN AISLPPLAAALIAIGALAAMTGALHEDGLGDTADGFFGASTPDRRLDIMKDSRIGTFAAL TLVIWTSVKASLLMAIIARAGAGYALLALIGTEAASRAGMLAFWHALPSARPGGLADSMG QPQWETVVCGCGLGLALLAIGFLPSGGMVALINALVLMTVVLFGFARLCMAKIGGQTGDT LGAAQQIGSLAALIGLVMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC7A2 (NM_003046) Human Tagged ORF Clone Lentiviral Particle
RC224871L3V 200 µL

SLC7A2 (NM_003046) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Npm1 (Nucleophosmin, Nucleolar phosphoprotein B23) discontinued
136294 50 µg

Npm1 (Nucleophosmin, Nucleolar phosphoprotein B23) discontinued

Sign In for Pricing
View Details
FANCD2 Rabbit pAb
MBS9143529-01 0.02 mL

FANCD2 Rabbit pAb

Sign In for Pricing
View Details
FANCD2 Rabbit pAb
MBS9143529-02 0.1 mL

FANCD2 Rabbit pAb

Sign In for Pricing
View Details
FANCD2 Rabbit pAb
MBS9143529-03 5x 0.1 mL

FANCD2 Rabbit pAb

Sign In for Pricing
View Details
Akr1c1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
11685116 3x 1.0 µg

Akr1c1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details