Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella ovis Cobalamin synthase (cobS)

This Recombinant Brucella ovis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A5VQ44

Expression Region

1-260

Origin

Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRNGLIGDTIRSLGFLSRLPLPQGWFDNTDDSLPRNARAFPLAGGILGLLAGVALLIAN AISLPPLAAALIAIGALAAMTGALHEDGLGDTADGFFGASTPDRRLDIMKDSRIGTFAAL TLVIWTSVKASLLMAIIARAGAGYALLALIGTEAASRAGMLAFWHALPSARPGGLADSMG QPQWETVVCGCGLGLALLAIGFLPSGGMVALINALVLMTVVLFGFARLCMAKIGGQTGDT LGAAQQIGSLAALIGLVMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHOX2B, ID (PHOX2B, PMX2B, Paired mesoderm homeobox protein 2B, Neuroblastoma Phox, PHOX2B homeodomain protein, Paired-like homeobox 2B)
039966 200 µL

PHOX2B, ID (PHOX2B, PMX2B, Paired mesoderm homeobox protein 2B, Neuroblastoma Phox, PHOX2B homeodomain protein, Paired-like homeobox 2B)

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (rNGFR/1965), CF740 conjugate, 0.1mg/mL
BNC742551-500 1x 500 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (rNGFR/1965), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Treponema Pallidum ispE Protein (aa 1-291) (strain SS14)
VAng-Cr1544-500gEcoli 500 µg (E. coli)

Recombinant Treponema Pallidum ispE Protein (aa 1-291) (strain SS14)

Sign In for Pricing
View Details
GCK Protein, Human
UA080298-01 10 µg

GCK Protein, Human

Sign In for Pricing
View Details
GCK Protein, Human
UA080298-02 50 μg (5x 10 μg)

GCK Protein, Human

Sign In for Pricing
View Details
GCK Protein, Human
UA080298-03 100 µg

GCK Protein, Human

Sign In for Pricing
View Details