Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella canis Cobalamin synthase (cobS)

This Recombinant Brucella canis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A9MAN9

Expression Region

1-260

Origin

Brucella canis (strain ATCC 23365 / NCTC 10854)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRNGLIGDTIRSLGFLSRLPLPQGWFDNTDDSLPRNARAFPLAGGILGLLAGVALLIAN AISLPPLAAALIAIGALAAMTGALHEDGLGDTADGFFGASTPDRRLDIMKDSRIGTFAAL TLVIWTGVKASLLMAIIARAGAGYALLALIGTEAASRAGMLAFWHALPSARPGGLADSMG QPQWETVVCGCGLGLALLAIGFLPSGGMVALINALVLMTVVLFGFARLCMAKIGGQTGDT LGAAQQIGSLAALIGLVMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHCHD4 Antibody (HRP)
orb243019-01 50 µg

CHCHD4 Antibody (HRP)

Sign In for Pricing
View Details
CHCHD4 Antibody (HRP)
orb243019-02 100 µg

CHCHD4 Antibody (HRP)

Sign In for Pricing
View Details
Anti-NELFA Antibody Picoband® Fluoro488 Conjugated
A07040-1-Fluoro488 100 µg/Vial

Anti-NELFA Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Anti-NOXO1 Antibody Picoband® PE Conjugated
A05047-2-PE 100 µg/Vial

Anti-NOXO1 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
Bovine Beta-Defensin 114 (DEFB114) ELISA Kit
OM621253 96 Strip Well

Bovine Beta-Defensin 114 (DEFB114) ELISA Kit

Sign In for Pricing
View Details
SHIP2 Rabbit Polyclonal Antibody
orb318844-01 30 µL

SHIP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details