Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella canis Cobalamin synthase (cobS)

This Recombinant Brucella canis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A9MAN9

Expression Region

1-260

Origin

Brucella canis (strain ATCC 23365 / NCTC 10854)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRNGLIGDTIRSLGFLSRLPLPQGWFDNTDDSLPRNARAFPLAGGILGLLAGVALLIAN AISLPPLAAALIAIGALAAMTGALHEDGLGDTADGFFGASTPDRRLDIMKDSRIGTFAAL TLVIWTGVKASLLMAIIARAGAGYALLALIGTEAASRAGMLAFWHALPSARPGGLADSMG QPQWETVVCGCGLGLALLAIGFLPSGGMVALINALVLMTVVLFGFARLCMAKIGGQTGDT LGAAQQIGSLAALIGLVMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAY 11-7082
442142-01 5 mg

BAY 11-7082

Sign In for Pricing
View Details
BAY 11-7082
442142-02 10 mg

BAY 11-7082

Sign In for Pricing
View Details
VEGFR2 (Ab-1175) Antibody
MBS9407325-01 0.05 mL

VEGFR2 (Ab-1175) Antibody

Sign In for Pricing
View Details
VEGFR2 (Ab-1175) Antibody
MBS9407325-02 0.1 mL

VEGFR2 (Ab-1175) Antibody

Sign In for Pricing
View Details
VEGFR2 (Ab-1175) Antibody
MBS9407325-03 5x 0.1 mL

VEGFR2 (Ab-1175) Antibody

Sign In for Pricing
View Details
Recombinant Ixodes scapularis UPF0608 protein ISCW013552 (ISCW013552), partial
MBS7068295-01 0.02 mg (E-Coli)

Recombinant Ixodes scapularis UPF0608 protein ISCW013552 (ISCW013552), partial

Sign In for Pricing
View Details