Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermodesulfovibrio yellowstonii Cobalamin synthase (cobS)

This Recombinant Thermodesulfovibrio yellowstonii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B5YL84

Expression Region

1-260

Origin

Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINRFLIALSFLTVLPLKFKEINEKELIRSIIFFPFIGFLEGVFCIFLVNIFKQIFSSSV ISIILLVFLFSVRGIFHIDGLSDTFDALFYKGTGQKEKDLQQRLQIMKDSVIGVAGAVAL VLDVLCRFAFVKELIDINQFLIFLFMFCFSRWIVIPLMYYGKPARTTGLGVLFIGKISSW QVIISTVLPIFLLVYFTIEKNFIFLPLIALFLFFISYILKKFFERKFNGITGDHLGATVE ITEIVFLICFLLGEKLWLSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcein Orange™ diacetate
22009-AAT 1 mg

Calcein Orange™ diacetate

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-500 1x 500 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS502540 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
CXorf49 (NM_001145140) Human Over-expression Lysate
LC428719 20 µg

CXorf49 (NM_001145140) Human Over-expression Lysate

Sign In for Pricing
View Details
ZRANB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A10]
TA810024AM 100 µL

ZRANB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A10]

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF740 conjugate, 0.1mg/mL
BNC743526-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details