Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 2 Cobalamin synthase (cobS)

This Recombinant Brucella melitensis biotype 2 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C0RIJ9

Expression Region

1-260

Origin

Brucella melitensis biotype 2 (strain ATCC 23457)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRNGLIGDTIRSLGFLSRLPLPQGWFDNTDDSLPRNARAFPLAGGILGLLAGVALLIAN AISLPPLAAALIAIGALAAMTGALHEDGLGDTADGFFGASTPDRRLDIMKDSRIGTFAAL TLVIWTGVKASLLMAIIARAGAGYALLALIGTEAASRAGMLAFWHALPSARPGGLADSMG QPQWETVVCGCGLGLALLAIGFLPSGGMVALINALVLMTVVLFGFARLCMAKIGGRTGDT LGAAQQIGSLAALIGLVMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, Multi (Epithelial Marker) (rKRT/457), 0.2mg/mL
BNUB1876-100 1x 100 µL

Cytokeratin, Multi (Epithelial Marker) (rKRT/457), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant TFF1/pS2 Monoclonal Antibody
AN301892L-01 50 µL

Recombinant TFF1/pS2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant TFF1/pS2 Monoclonal Antibody
AN301892L-02 100 µL

Recombinant TFF1/pS2 Monoclonal Antibody

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1792), CF488A conjugate, 0.1mg/mL
BNC881792-100 1x 100 µL

SOX2 (Transcription Factor) (SOX2/1792), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bismuth(III) Chloride
TRC-B497368-500MG 500 mg

Bismuth(III) Chloride

Sign In for Pricing
View Details
FKBP2 (NM_004470) Human Over-expression Lysate
LC401423 20 µg

FKBP2 (NM_004470) Human Over-expression Lysate

Sign In for Pricing
View Details