Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 2 Cobalamin synthase (cobS)

This Recombinant Brucella melitensis biotype 2 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C0RIJ9

Expression Region

1-260

Origin

Brucella melitensis biotype 2 (strain ATCC 23457)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRNGLIGDTIRSLGFLSRLPLPQGWFDNTDDSLPRNARAFPLAGGILGLLAGVALLIAN AISLPPLAAALIAIGALAAMTGALHEDGLGDTADGFFGASTPDRRLDIMKDSRIGTFAAL TLVIWTGVKASLLMAIIARAGAGYALLALIGTEAASRAGMLAFWHALPSARPGGLADSMG QPQWETVVCGCGLGLALLAIGFLPSGGMVALINALVLMTVVLFGFARLCMAKIGGRTGDT LGAAQQIGSLAALIGLVMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Carboxyvanillic Acid
TRC-C183315-500MG 500 mg

5-Carboxyvanillic Acid

Sign In for Pricing
View Details
GRP94 Antibody: Biotin
SPC-101D-BI 100 µg

GRP94 Antibody: Biotin

Sign In for Pricing
View Details
Collagen II (COL2A1) Human Gene Knockout Kit (CRISPR)
KN418041 1 Kit

Collagen II (COL2A1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Trypsin (PRSS3) Rabbit Polyclonal Antibody
AP20794PU-N 100 µg

Trypsin (PRSS3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SRC pTyr416 Mouse Monoclonal Antibody [Clone ID: 9A6]
AM00145PU-N 100 µg

SRC pTyr416 Mouse Monoclonal Antibody [Clone ID: 9A6]

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR562517 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details