Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella suis Cobalamin synthase (cobS)

This Recombinant Brucella suis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B0CLJ1

Expression Region

1-260

Origin

Brucella suis (strain ATCC 23445 / NCTC 10510)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRNGLIGDTIRSLGFLSRLPLPQGWFDNTDDSLPRNARAFPLAGGILGLLAGVALLIAN AISLPPLAAALIAIGALAAMTGALHEDGLGDTADGFFGASTPDRRLDIMKDSRIGTFAAL TLVIWTGVKASLLMAIIARAGAGYALLALIGTEAASRAGMLAFWHALPSARPGGLADSMG QPQWETVVCGCGLGLALLAIGFLPSGGMVALINALVLMTVVLFGFARLCMAKIGGQTGDT LGAAQQIGSLAALIGLVMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KCNA5 Antibody
MBS178295-01 0.01 mg

Anti-KCNA5 Antibody

Sign In for Pricing
View Details
Anti-KCNA5 Antibody
MBS178295-02 0.1 mg (Carrier Free)

Anti-KCNA5 Antibody

Sign In for Pricing
View Details
Anti-KCNA5 Antibody
MBS178295-03 0.1 mg

Anti-KCNA5 Antibody

Sign In for Pricing
View Details
Anti-KCNA5 Antibody
MBS178295-04 0.1 mg (Cy3)

Anti-KCNA5 Antibody

Sign In for Pricing
View Details
Anti-KCNA5 Antibody
MBS178295-05 0.1 mg (Biotin)

Anti-KCNA5 Antibody

Sign In for Pricing
View Details
Anti-KCNA5 Antibody
MBS178295-06 0.1 mg (HRP)

Anti-KCNA5 Antibody

Sign In for Pricing
View Details