Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Type-2 angiotensin II receptor (AGTR2)

This Recombinant Sheep Type-2 angiotensin II receptor (AGTR2) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Type-2 angiotensin II receptor, Angiotensin II type-2 receptor, AT2

UniProt

Q28929

Expression Region

1-260

Origin

Ovis aries (Sheep)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PVLYYIIWGVGFLVNTIVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSHR YDWIFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLG WCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFI ATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVI NSCEVIAVIDLALPFAILLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycocholic Acid Hydrate Sodium Salt
TRC-G641360-5G 5 g

Glycocholic Acid Hydrate Sodium Salt

Sign In for Pricing
View Details
GCSH Polyclonal Antibody
E-AB-53060-01 20 µL

GCSH Polyclonal Antibody

Sign In for Pricing
View Details
GCSH Polyclonal Antibody
E-AB-53060-02 60 µL

GCSH Polyclonal Antibody

Sign In for Pricing
View Details
GCSH Polyclonal Antibody
E-AB-53060-03 120 µL

GCSH Polyclonal Antibody

Sign In for Pricing
View Details
GCSH Polyclonal Antibody
E-AB-53060-04 200 µL

GCSH Polyclonal Antibody

Sign In for Pricing
View Details
LIMK2 (Ab-505) Antibody
8B7141-AAT 50 µg

LIMK2 (Ab-505) Antibody

Sign In for Pricing
View Details