Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Type-2 angiotensin II receptor (AGTR2)

This Recombinant Sheep Type-2 angiotensin II receptor (AGTR2) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Type-2 angiotensin II receptor, Angiotensin II type-2 receptor, AT2

UniProt

Q28929

Expression Region

1-260

Origin

Ovis aries (Sheep)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PVLYYIIWGVGFLVNTIVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSHR YDWIFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLG WCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFI ATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVI NSCEVIAVIDLALPFAILLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lens culinaris Gel -LcH- Immobilized Lectin
A-1401-2 2 mL

Lens culinaris Gel -LcH- Immobilized Lectin

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Rat CD45 Antibody[OX-1]
E-AB-F1227US-01 25 µg

Elab Fluor® Red 780 Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Rat CD45 Antibody[OX-1]
E-AB-F1227US-02 100 µg

Elab Fluor® Red 780 Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing
View Details
ANKRD18B (N-term) Rabbit Polyclonal Antibody
AP50184PU-N 400 µL

ANKRD18B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Variable Volume 12 Channel Micropipette BPIP-329
BPIP-329 1 Unit

Variable Volume 12 Channel Micropipette BPIP-329

Sign In for Pricing
View Details
ADAM11 Rabbit Polyclonal Antibody
TA373251 100 µL

ADAM11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details