Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Phosphatidate cytidylyltransferase (cdsA)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Phosphatidate cytidylyltransferase (cdsA) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Phosphatidate cytidylyltransferase, EC= 2.7.7.41, CDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase, CDS, CDP-diglyceride pyrophosphorylase, CDP-diglyceride syn

UniProt

Q49X46

Expression Region

1-260

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVRTLTAIIALIVFLPVLLKGGLILMLFSYLLAFIALKELLNMNMIKFLSIPGIISALG ILIIMLPQDAGSWVNDLQLKSLIAMSFILLSYTVLSKNRFSFMDAAFCLMSIAYVGIGFM YLYETRSEGLHYILFAFLVVWLTDTGAYIFGRLMGKHKLWPVISPNKTVEGFVGGLICSL IVPLVMMIFVDFNIALWLLLIITIILSMFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL DRFDSFMFVLPLLNILLIQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD11B1 (Corticosteroid 11-beta-dehydrogenase isozyme 1) BioAssayTM ELISA Kit (Human) discontinued
356351-01 48 Tests

HSD11B1 (Corticosteroid 11-beta-dehydrogenase isozyme 1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
HSD11B1 (Corticosteroid 11-beta-dehydrogenase isozyme 1) BioAssayTM ELISA Kit (Human) discontinued
356351-02 96 Tests

HSD11B1 (Corticosteroid 11-beta-dehydrogenase isozyme 1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
LAPTM4B (NM_018407) Human Tagged ORF Clone
RC207325 10 µg

LAPTM4B (NM_018407) Human Tagged ORF Clone

Sign In for Pricing
View Details
DUSP26, Recombinant, Human, aa1-211, His-Tag (Dual specificity protein phosphatase 26)
349864-01 100 µg

DUSP26, Recombinant, Human, aa1-211, His-Tag (Dual specificity protein phosphatase 26)

Sign In for Pricing
View Details
DUSP26, Recombinant, Human, aa1-211, His-Tag (Dual specificity protein phosphatase 26)
349864-02 500 µg

DUSP26, Recombinant, Human, aa1-211, His-Tag (Dual specificity protein phosphatase 26)

Sign In for Pricing
View Details
LOC685544 Rat shRNA Lentiviral Particle (Locus ID 685544)
TL707964V 500 µL Each

LOC685544 Rat shRNA Lentiviral Particle (Locus ID 685544)

Sign In for Pricing
View Details