Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Phosphatidate cytidylyltransferase (cdsA)

This Recombinant Staphylococcus aureus Phosphatidate cytidylyltransferase (cdsA) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Phosphatidate cytidylyltransferase, EC= 2.7.7.41, CDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase, CDS, CDP-diglyceride pyrophosphorylase, CDP-diglyceride syn

UniProt

Q5HGH0

Expression Region

1-260

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVRTLTAIIALIVFLPILLKGGLVLMIFANILALIALKELLNMNMIKFVSVPGLISAVG LIIIMLPQHAGPWVQVIQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFM FFYETRSEGLHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGLFCSL IVPLAMLYFVDFNMNVWILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL DRFDSFMFVLPLLNILLIQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB26 (NM_020924) Human Recombinant Protein
TP761529 50 µg

ZBTB26 (NM_020924) Human Recombinant Protein

Sign In for Pricing
View Details
SEI-1 Antibody
MBS8517722-01 0.05 mg

SEI-1 Antibody

Sign In for Pricing
View Details
SEI-1 Antibody
MBS8517722-02 0.1 mg

SEI-1 Antibody

Sign In for Pricing
View Details
SEI-1 Antibody
MBS8517722-03 0.1 mL (AF750)

SEI-1 Antibody

Sign In for Pricing
View Details
SEI-1 Antibody
MBS8517722-04 0.1 mL (AF405M)

SEI-1 Antibody

Sign In for Pricing
View Details
SEI-1 Antibody
MBS8517722-05 0.1 mL (AF546)

SEI-1 Antibody

Sign In for Pricing
View Details