Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Phosphatidate cytidylyltransferase (cdsA)

This Recombinant Staphylococcus epidermidis Phosphatidate cytidylyltransferase (cdsA) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Phosphatidate cytidylyltransferase, EC= 2.7.7.41, CDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase, CDS, CDP-diglyceride pyrophosphorylase, CDP-diglyceride syn

UniProt

Q5HPT0

Expression Region

1-260

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVRTLTAIIALLIFLPILLKGGLILMLFAFLLALIALKELLNMNMIKFLSIPGLISALA LIIIMLPQDAGEWVQVIQLKGLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFM YFYETRSEGLRYILFAFLIVWLTDTGAYIFGRLMGKHKLWPVISPNKTIEGFFGGILCSI LVPLVMQMFVDLHMNIWLLLLVTIVLSMFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL DRFDSFMFVLPLLNILLIQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIH1D1 Human Gene Knockout Kit (CRISPR)
KN400158 1 Kit

PIH1D1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATP6V0D1 (NM_004691) Human Recombinant Protein
TP303498 20 µg

ATP6V0D1 (NM_004691) Human Recombinant Protein

Sign In for Pricing
View Details
Melittin Trifluoroacetic Acid Salt (~80%)
TRC-M215493-25MG 25 mg

Melittin Trifluoroacetic Acid Salt (~80%)

Sign In for Pricing
View Details
Recombinant CETP Antibody
RC-15382-01 50 μL

Recombinant CETP Antibody

Sign In for Pricing
View Details
Recombinant CETP Antibody
RC-15382-02 100 µL

Recombinant CETP Antibody

Sign In for Pricing
View Details
Recombinant CETP Antibody
RC-15382-03 1 mL

Recombinant CETP Antibody

Sign In for Pricing
View Details