Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant O-antigen export system permease protein rfbA (rfbA)

This Recombinant O-antigen export system permease protein rfbA (rfbA) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

O-antigen export system permease protein rfbA

UniProt

Q50862

Expression Region

1-260

Origin

Myxococcus xanthus

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIRLVRELYQYRGLLISLVQRELKARYRGSFLGFLWTFLNPTLHMLVYVLLFTVVMRQNI PNFPFFMFVGLLPWIWFSTSVGGGASAISDRRDLLTKVRFPAQVLPTSVVVTNLCNFVLS LPLMLVLGMAYGQWPTWHVVLFPVVVLIQLTFTLALTYILAAINVTFRDLQHIVSNLLTL WFFATPVLYPLSTIQDESARSLMLALNPMVSLMTSYQAIFYEHRLPDAEPLMALAAVSVV LLWAASSIFESRREEFAESI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP9-1 sgRNA CRISPR Lentivector set (Human)
K1184501 3x 1.0 µg

KRTAP9-1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
PRDM8 (PR Domain Zinc Finger Protein 8)
489323 100 µL

PRDM8 (PR Domain Zinc Finger Protein 8)

Sign In for Pricing
View Details
JAM3 Knockout HGC-27 Polyclonal Cells
ARG30116 1 Million

JAM3 Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details
Pigp (NM_001159620) Mouse Tagged Lenti ORF Clone
MR216764L3 10 µg

Pigp (NM_001159620) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Bacillus cereus UPF0753 protein BCAH187_A3197 (BCAH187_A3197), partial
MBS1224035 Inquire

Recombinant Bacillus cereus UPF0753 protein BCAH187_A3197 (BCAH187_A3197), partial

Sign In for Pricing
View Details
Beta-Methylcholine Chloride D3
CS-O-53600 1 Each

Beta-Methylcholine Chloride D3

Sign In for Pricing
View Details