Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant O-antigen export system permease protein rfbA (rfbA)

This Recombinant O-antigen export system permease protein rfbA (rfbA) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

O-antigen export system permease protein rfbA

UniProt

Q50862

Expression Region

1-260

Origin

Myxococcus xanthus

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIRLVRELYQYRGLLISLVQRELKARYRGSFLGFLWTFLNPTLHMLVYVLLFTVVMRQNI PNFPFFMFVGLLPWIWFSTSVGGGASAISDRRDLLTKVRFPAQVLPTSVVVTNLCNFVLS LPLMLVLGMAYGQWPTWHVVLFPVVVLIQLTFTLALTYILAAINVTFRDLQHIVSNLLTL WFFATPVLYPLSTIQDESARSLMLALNPMVSLMTSYQAIFYEHRLPDAEPLMALAAVSVV LLWAASSIFESRREEFAESI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC8E Recombinant Protein (Human)
RP018298 100 µg

LRRC8E Recombinant Protein (Human)

Sign In for Pricing
View Details
Dipeptidylpeptidase 8/DPP8 Antibody
orb1534516 50 µg

Dipeptidylpeptidase 8/DPP8 Antibody

Sign In for Pricing
View Details
Anti-SDF1 alpha  (2A1)
YF-MA15383 100 ug

Anti-SDF1 alpha (2A1)

Sign In for Pricing
View Details
Lentiviral human NOLC1 shRNA (UAS) - Lentiviral human NOLC1 shRNA (UAS, RFP) plasmid
GTR15115993 1 Vial

Lentiviral human NOLC1 shRNA (UAS) - Lentiviral human NOLC1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Mup20 Mouse shRNA Plasmid (Locus ID 381530)
TR508611 1 Kit

Mup20 Mouse shRNA Plasmid (Locus ID 381530)

Sign In for Pricing
View Details
Complete Medium for SF126 Cells
abx703540 500 mL

Complete Medium for SF126 Cells

Sign In for Pricing
View Details