Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema denticola Cobalamin synthase (cobS)

This Recombinant Treponema denticola Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q73K39

Expression Region

1-260

Origin

Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGFILALQFFTRIPININIDFNEKNIKRAFYFLPLIGGLIAGLVLIPIYFLPQKYIEIS GFISLLLYLFLTGSIHLDGVGDTIDGFFSARKKEKILEIMQDPRIGTYGTIGLNVFLLLR YINYSTIIPDAGLLILAGIISRLSGLAVVVFSKPAKDTGLGLLFHKSASKFSFFFWLVLV CFLSLFTPEIAAFSKIQGTFILVERLKYLLLPLTAFILTFIIIRISYKKIGGITGDVNGL IVELTELAVLSTSFFINVHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human IL-8 Antibody
GWB-817E77 1 mL

Anti-Human IL-8 Antibody

Sign In for Pricing
View Details
Nav1.8 (SCN10A) (NM_001293306) Human Tagged ORF Clone
RG240225 10 µg

Nav1.8 (SCN10A) (NM_001293306) Human Tagged ORF Clone

Sign In for Pricing
View Details
RPL7AP34 3'UTR GFP Stable Cell Line
TU070527 1.0 mL

RPL7AP34 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
VOM2R60 Adenovirus (Rat)
50140056 1.0 mL

VOM2R60 Adenovirus (Rat)

Sign In for Pricing
View Details
Pea3/ETV4 Rabbit Polyclonal Antibody (Cy3)
orb2619774 100 µg

Pea3/ETV4 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Mouse Lrrfip1 ELISA KIT
ELI-12612m 96 Tests

Mouse Lrrfip1 ELISA KIT

Sign In for Pricing
View Details