Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema denticola Cobalamin synthase (cobS)

This Recombinant Treponema denticola Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q73K39

Expression Region

1-260

Origin

Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGFILALQFFTRIPININIDFNEKNIKRAFYFLPLIGGLIAGLVLIPIYFLPQKYIEIS GFISLLLYLFLTGSIHLDGVGDTIDGFFSARKKEKILEIMQDPRIGTYGTIGLNVFLLLR YINYSTIIPDAGLLILAGIISRLSGLAVVVFSKPAKDTGLGLLFHKSASKFSFFFWLVLV CFLSLFTPEIAAFSKIQGTFILVERLKYLLLPLTAFILTFIIIRISYKKIGGITGDVNGL IVELTELAVLSTSFFINVHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akap3 3'UTR Lenti-reporter-Luc Vector
11653084 1.0 µg

Akap3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Monkey Spinal cord Total RNA, Rhesus
UR-230 0.05 mg

Monkey Spinal cord Total RNA, Rhesus

Sign In for Pricing
View Details
Recombinant Mycoplasma Hyopneumoniae recA Protein (aa 1-337) (strain 7448)
VAng-Lsx06515-50gEcoli 50 µg (E. coli)

Recombinant Mycoplasma Hyopneumoniae recA Protein (aa 1-337) (strain 7448)

Sign In for Pricing
View Details
LXR alpha (NR1H3) Rabbit Monoclonal Antibody
TA423087 100 µL

LXR alpha (NR1H3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse 4930415O20Rik shRNA (UAS) - Lentiviral mouse 4930415O20Rik shRNA (UAS, RFP) (25)
GTR15249851 1 Vial

Lentiviral mouse 4930415O20Rik shRNA (UAS) - Lentiviral mouse 4930415O20Rik shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Spindoc Mouse shRNA Lentiviral Particle (Locus ID 68229)
TL515821V 500 µL Each

Spindoc Mouse shRNA Lentiviral Particle (Locus ID 68229)

Sign In for Pricing
View Details