Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Phosphatidate cytidylyltransferase (cdsA)

This Recombinant Staphylococcus aureus Phosphatidate cytidylyltransferase (cdsA) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Phosphatidate cytidylyltransferase, EC= 2.7.7.41, CDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase, CDS, CDP-diglyceride pyrophosphorylase, CDP-diglyceride syn

UniProt

Q7A5Y4

Expression Region

1-260

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVRTLTAIIALIVFLPILLKGGLVLMIFANILALIALKELLNMNMIKFVSVPGLISAVG LIIIMLPQHAGPWVQVIQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFM FFYETRSEGLHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGLFCSL IVPLAMLYFVDFNMNVWILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL DRFDSFMFVLPLLNILLIQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saguinus imperator Melanocyte-stimulating hormone receptor (MC1R)
MBS7019926-01 0.02 mg

Recombinant Saguinus imperator Melanocyte-stimulating hormone receptor (MC1R)

Sign In for Pricing
View Details
Recombinant Saguinus imperator Melanocyte-stimulating hormone receptor (MC1R)
MBS7019926-02 0.1 mg

Recombinant Saguinus imperator Melanocyte-stimulating hormone receptor (MC1R)

Sign In for Pricing
View Details
Recombinant Saguinus imperator Melanocyte-stimulating hormone receptor (MC1R)
MBS7019926-03 5x 0.1 mg

Recombinant Saguinus imperator Melanocyte-stimulating hormone receptor (MC1R)

Sign In for Pricing
View Details
Anti-GNAO1 Antibody Picoband® Fluoro594 Conjugated
A05532-2-Fluoro594 100 µg/Vial

Anti-GNAO1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Polyclonal Antibody to Aquaporin 1 (AQP1)
TRV-0052810-01 20 µL

Polyclonal Antibody to Aquaporin 1 (AQP1)

Sign In for Pricing
View Details
Polyclonal Antibody to Aquaporin 1 (AQP1)
TRV-0052810-02 100 µL

Polyclonal Antibody to Aquaporin 1 (AQP1)

Sign In for Pricing
View Details