Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Phosphatidate cytidylyltransferase (cdsA)

This Recombinant Staphylococcus epidermidis Phosphatidate cytidylyltransferase (cdsA) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Phosphatidate cytidylyltransferase, EC= 2.7.7.41, CDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase, CDS, CDP-diglyceride pyrophosphorylase, CDP-diglyceride syn

UniProt

Q8CST9

Expression Region

1-260

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVRTLTAIIALLIFLPILLKGGLILMLFAFLLALIALKELLNMNMIKFLSIPGLISALA LIIIMLPQDAGEWVQVIQLKGLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFM YFYETRSEGLRYILFAFLIVWLTDTGAYIFGRLMGKHKLWPVISPNKTIEGFFGGILCSI LVPLVMQMFVDLHMNIWLLLLVTIVLSMFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL DRFDSFMFVLPLLNILLIQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein 6 (KLK6) Rat ELISA Kit
E4718 96 Tests

Kallikrein 6 (KLK6) Rat ELISA Kit

Sign In for Pricing
View Details
Cyclooxygenase-2 (PTGS2, Prostaglandin G/H Synthase 2, COX-2, PHS II, Prostaglandin H2 Synthase 2, PGH Synthase 2, PGHS-2, Prostaglandin-endoperoxide Synthase 2) discontinued. see C7904-82W
C7904-83L 50 µg

Cyclooxygenase-2 (PTGS2, Prostaglandin G/H Synthase 2, COX-2, PHS II, Prostaglandin H2 Synthase 2, PGH Synthase 2, PGHS-2, Prostaglandin-endoperoxide Synthase 2) discontinued. see C7904-82W

Sign In for Pricing
View Details
NEK10 (NM_001031741) Human Over-expression Lysate
LS152110-20ug 20 µg

NEK10 (NM_001031741) Human Over-expression Lysate

Sign In for Pricing
View Details
Bovine PCNP / PEST proteolytic signal-containing nuclear protein ELISA Kit
MBS2906423-01 48 Well

Bovine PCNP / PEST proteolytic signal-containing nuclear protein ELISA Kit

Sign In for Pricing
View Details
Bovine PCNP / PEST proteolytic signal-containing nuclear protein ELISA Kit
MBS2906423-02 96 Well

Bovine PCNP / PEST proteolytic signal-containing nuclear protein ELISA Kit

Sign In for Pricing
View Details
Bovine PCNP / PEST proteolytic signal-containing nuclear protein ELISA Kit
MBS2906423-03 5x 96 Well

Bovine PCNP / PEST proteolytic signal-containing nuclear protein ELISA Kit

Sign In for Pricing
View Details