Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella suis biovar 1 Cobalamin synthase (cobS)

This Recombinant Brucella suis biovar 1 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8G156

Expression Region

1-260

Origin

Brucella suis biovar 1 (strain 1330)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRNGLIGDTIRSLGFLSRLPLPQGWFDNTDDSLPRNARAFPLAGGILGLLAGVALLIAN AISLPPLAAALIAIGALAAMTGALHEDGLGDTADGFFGASTPDRRLDIMKDSRIGTFAAL TLVIWTGVKASLLMAIIARAGAGYALLALIGTEAASRAGMLAFWHALPSARPGGLADSMG QPQWETVVCGCGLGLALLAIGFLPSGGMVALINALVLMTVVLFGFARLCMAKIGGQTGDT LGAAQQIGSLAALIGLVMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human NRN1L sgRNA gene knockout kit - Lentiviral human NRN1L sgRNA gene knockout kit (100)
GTR15366772 1 Vial

Lentiviral human NRN1L sgRNA gene knockout kit - Lentiviral human NRN1L sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Slc16a10 ORF Vector (Mouse) (pORF)
ORF057438 1.0 µg DNA

Slc16a10 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Monoclonal Myosin heavy chain 11 Antibody (MYH11/8185R) [Alexa Fluor 350]
NBP3-24304AF350 0.1 mL

Rabbit Monoclonal Myosin heavy chain 11 Antibody (MYH11/8185R) [Alexa Fluor 350]

Sign In for Pricing
View Details
Human GEMIN2 Pre-designed siRNA Set A
SI006175A 1 Each

Human GEMIN2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Mouse Membrane protein FAM159B (Fam159b) , partial
MBS7101707 Inquire

Recombinant Mouse Membrane protein FAM159B (Fam159b) , partial

Sign In for Pricing
View Details
Hemopexin Rabbit mAb
MBS9470476-01 0.05 mL

Hemopexin Rabbit mAb

Sign In for Pricing
View Details