Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella suis biovar 1 Cobalamin synthase (cobS)

This Recombinant Brucella suis biovar 1 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8G156

Expression Region

1-260

Origin

Brucella suis biovar 1 (strain 1330)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRNGLIGDTIRSLGFLSRLPLPQGWFDNTDDSLPRNARAFPLAGGILGLLAGVALLIAN AISLPPLAAALIAIGALAAMTGALHEDGLGDTADGFFGASTPDRRLDIMKDSRIGTFAAL TLVIWTGVKASLLMAIIARAGAGYALLALIGTEAASRAGMLAFWHALPSARPGGLADSMG QPQWETVVCGCGLGLALLAIGFLPSGGMVALINALVLMTVVLFGFARLCMAKIGGQTGDT LGAAQQIGSLAALIGLVMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTRF1L Protein Vector (Rat) (pPM-C-HA)
31093026 500 ng

MTRF1L Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Gm13194 Rabbit Polyclonal Antibody (HRP)
orb2089508 100 µL

Gm13194 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Flcn (NM_146018) Mouse Recombinant Protein
PM45621M5 20 µg

Flcn (NM_146018) Mouse Recombinant Protein

Sign In for Pricing
View Details
CD70 (TNFS7/1026), CF488A conjugate, 0.1mg/mL
BNC881026-500 1x 500 µL

CD70 (TNFS7/1026), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 4 (FGF4) ELISA Kit
DLR-FGF4-Hu-01 48 Tests

Human Fibroblast Growth Factor 4 (FGF4) ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 4 (FGF4) ELISA Kit
DLR-FGF4-Hu-02 96 Tests

Human Fibroblast Growth Factor 4 (FGF4) ELISA Kit

Sign In for Pricing
View Details