Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Cobalamin synthase (cobS)

This Recombinant Brucella melitensis biotype 1 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8YGQ8

Expression Region

1-260

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRNGLIGDTIRSLGFLSRLPLPQGWFDNTDDSLPRNARAFPLAGGILGLLAGVALLIAN AISLPPLAAALIAIGALAAMTGALHEDGLGDTADGFFGASTPDRRLDIMKDSRIGTFAAL TLVIWTGVKASLLMAIIARAGAGYALLALIGTEAASRAGMLAFWHALPSARPGGLADSMG QPQWETVVCGCGLGLALLAIGFLPSGGMVALINALVLMTVVLFGFARLCMAKIGGRTGDT LGAAQQIGSLAALIGLVMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Golgin subfamily A member 8Q (GOG8Q)
orb3009182-01 20 µg

Recombinant Human Golgin subfamily A member 8Q (GOG8Q)

Sign In for Pricing
View Details
Recombinant Human Golgin subfamily A member 8Q (GOG8Q)
orb3009182-02 100 µg

Recombinant Human Golgin subfamily A member 8Q (GOG8Q)

Sign In for Pricing
View Details
Recombinant Human Golgin subfamily A member 8Q (GOG8Q)
orb3009182-03 1 mg

Recombinant Human Golgin subfamily A member 8Q (GOG8Q)

Sign In for Pricing
View Details
RFC5 Human Over-expression Lysate
orb1347453 100 µg

RFC5 Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-Abl1 (T735) Polyclonal Antibody
JOT-PHS00419-01 20 µL

Phospho-Abl1 (T735) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Abl1 (T735) Polyclonal Antibody
JOT-PHS00419-02 50 μL

Phospho-Abl1 (T735) Polyclonal Antibody

Sign In for Pricing
View Details