Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Cobalamin synthase (cobS)

This Recombinant Brucella melitensis biotype 1 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8YGQ8

Expression Region

1-260

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRNGLIGDTIRSLGFLSRLPLPQGWFDNTDDSLPRNARAFPLAGGILGLLAGVALLIAN AISLPPLAAALIAIGALAAMTGALHEDGLGDTADGFFGASTPDRRLDIMKDSRIGTFAAL TLVIWTGVKASLLMAIIARAGAGYALLALIGTEAASRAGMLAFWHALPSARPGGLADSMG QPQWETVVCGCGLGLALLAIGFLPSGGMVALINALVLMTVVLFGFARLCMAKIGGRTGDT LGAAQQIGSLAALIGLVMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRITC-dextran 150kDa, 100mg
CTD150-100mg 100 mg

TRITC-dextran 150kDa, 100mg

Sign In for Pricing
View Details
TNIP3, NT (TNIP3, ABIN3, LIND, TNFAIP3-interacting protein 3, A20-binding inhibitor of NF-kappa-B activation 3, Listeria-induced gene protein) (MaxLight 405)
MBS6357125-01 0.1 mL

TNIP3, NT (TNIP3, ABIN3, LIND, TNFAIP3-interacting protein 3, A20-binding inhibitor of NF-kappa-B activation 3, Listeria-induced gene protein) (MaxLight 405)

Sign In for Pricing
View Details
TNIP3, NT (TNIP3, ABIN3, LIND, TNFAIP3-interacting protein 3, A20-binding inhibitor of NF-kappa-B activation 3, Listeria-induced gene protein) (MaxLight 405)
MBS6357125-02 5x 0.1 mL

TNIP3, NT (TNIP3, ABIN3, LIND, TNFAIP3-interacting protein 3, A20-binding inhibitor of NF-kappa-B activation 3, Listeria-induced gene protein) (MaxLight 405)

Sign In for Pricing
View Details
ANO7 Protein Vector (Rat) (pPB-N-His)
PV253775 500 ng

ANO7 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Nosopharyngeal Carinmoma NPC ELISA Kit
BG-MUS11660 1 Each

Mouse Nosopharyngeal Carinmoma NPC ELISA Kit

Sign In for Pricing
View Details
Atp10d Rabbit Polyclonal Antibody (FITC)
orb2113017 100 µL

Atp10d Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details