Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Cobalamin synthase (cobS)

This Recombinant Brucella melitensis biotype 1 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8YGQ8

Expression Region

1-260

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRNGLIGDTIRSLGFLSRLPLPQGWFDNTDDSLPRNARAFPLAGGILGLLAGVALLIAN AISLPPLAAALIAIGALAAMTGALHEDGLGDTADGFFGASTPDRRLDIMKDSRIGTFAAL TLVIWTGVKASLLMAIIARAGAGYALLALIGTEAASRAGMLAFWHALPSARPGGLADSMG QPQWETVVCGCGLGLALLAIGFLPSGGMVALINALVLMTVVLFGFARLCMAKIGGRTGDT LGAAQQIGSLAALIGLVMAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF4/12 Antibody
MBS9409529-01 0.05 mL

TCF4/12 Antibody

Sign In for Pricing
View Details
TCF4/12 Antibody
MBS9409529-02 0.1 mL

TCF4/12 Antibody

Sign In for Pricing
View Details
TCF4/12 Antibody
MBS9409529-03 5x 0.1 mL

TCF4/12 Antibody

Sign In for Pricing
View Details
IRS1 Rabbit pAb, PerCP-Cy7 conjugated
orb2889869 100 µL

IRS1 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Arrestin 3 Antibody / ARR3
R36442-100UG 100 µg

Arrestin 3 Antibody / ARR3

Sign In for Pricing
View Details
SLC2A1 Antibody
MBS9411109-01 0.1 mL

SLC2A1 Antibody

Sign In for Pricing
View Details