Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Phosphatidate cytidylyltransferase (cdsA)

This Recombinant Staphylococcus aureus Phosphatidate cytidylyltransferase (cdsA) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Phosphatidate cytidylyltransferase, EC= 2.7.7.41, CDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase, CDS, CDP-diglyceride pyrophosphorylase, CDP-diglyceride syn

UniProt

Q99UL1

Expression Region

1-260

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVRTLTAIIALIVFLPILLKGGLVLMIFANILALIALKELLNMNMIKFVSVPGLISAVG LIIIMLPQHAGPWVQVIQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFM FFYETRSEGLHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGLFCSL IVPLAMLYFVDFNMNVWILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL DRFDSFMFVLPLLNILLIQS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX6 Antibody - middle region : FITC (ARP65275_P050-FITC)
ARP65275_P050-FITC 100 µL

SNX6 Antibody - middle region : FITC (ARP65275_P050-FITC)

Sign In for Pricing
View Details
ARFBP1 Rabbit Polyclonal Antibody (Cy7)
orb1057716 100 µL

ARFBP1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
RANGE H - Universal active coal filter - Compliant with F2-BE
CORG53 each

RANGE H - Universal active coal filter - Compliant with F2-BE

Sign In for Pricing
View Details
Lentiviral human TIGAR shRNA (UAS) - Lentiviral human TIGAR shRNA (UAS) (100)
GTR15119694 1 Vial

Lentiviral human TIGAR shRNA (UAS) - Lentiviral human TIGAR shRNA (UAS) (100)

Sign In for Pricing
View Details
Alcam ORF Vector (Rat) (pORF)
11720016 1.0 µg DNA

Alcam ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
KLHDC10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
25763061 1.0 µg DNA

KLHDC10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details