Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio cholerae serotype O1 Cobalamin synthase (cobS)

This Recombinant Vibrio cholerae serotype O1 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C3LLT4

Expression Region

1-261

Origin

Vibrio cholerae serotype O1 (strain M66-2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAILRYQLELFLLAVSFFSRIPVPVSLPYSSERMNQAGRYFALVGLLLGAICALVYSLA TQLFSTNISVFLTMVLSLLLTGAFHEDGLADMADGVGGGMTAERRLEIMKDSRIGTYGSS ALIMVLLGKYLLLTELADLTSLVPVWLLAYTLSRAVAASLIRNTPYVSDTDSSKSKPLAQ QLSGTDVAVLSLTALATLLYFSWQFIGVMIAASLIFRQIFRQWLIRRLGGFTGDCLGAAQ QLMEILIYLILLAFLQHEVMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Human IgM Antibody[MHM-88]
E-AB-F1172H-01 20 Tests

PE/Cyanine7 Anti-Human IgM Antibody[MHM-88]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human IgM Antibody[MHM-88]
E-AB-F1172H-02 100 Tests

PE/Cyanine7 Anti-Human IgM Antibody[MHM-88]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human IgM Antibody[MHM-88]
E-AB-F1172H-03 2x 100 Tests

PE/Cyanine7 Anti-Human IgM Antibody[MHM-88]

Sign In for Pricing
View Details
MRPL33 Antibody
8C16671-AAT 50 µg

MRPL33 Antibody

Sign In for Pricing
View Details
ARFRP1 Recombinant Rabbit Monoclonal Antibody [JE63-32]
HA721020 100 µL

ARFRP1 Recombinant Rabbit Monoclonal Antibody [JE63-32]

Sign In for Pricing
View Details
N-Acetyl Sulfapyridine
TRC-A187910-50MG 50 mg

N-Acetyl Sulfapyridine

Sign In for Pricing
View Details