Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xylella fastidiosa Undecaprenyl-diphosphatase (uppP)

This Recombinant Xylella fastidiosa Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q87CN8

Expression Region

1-261

Origin

Xylella fastidiosa (strain Temecula1 / ATCC 700964)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFELFTALMLGILEGITEFLPVSSTGHLLIAEHWLGSRSDFFNIVIQAGAILAITFVFRK KVWSLATGLDKYSNRDYVMKLATAFLITAVVGLAVRKANWQLPETIQPIAWALIIGGIWI LIAESVAKHLPERENVTWSVAIAVGLAQVVAGVFPGTSRSASTIFLAMLLGLSKRSAAAE FSFLVGIPTMFSASSYACFELFKRGELLHENWLEVSVAFVAAMLTGFAVVKWLLGYIKNH SFAPFAYYRIALGLVLLTWLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-100 1x 100 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
BNC040676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-100 1x 100 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (LAMP3/968), CF647 conjugate, 0.1mg/mL
BNC470968-500 1x 500 µL

CD63 (LAMP3/968), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3/863), CF640R conjugate, 0.1mg/mL
BNC400863-500 1x 500 µL

Glypican-3 (GPC3/863), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details