Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Schizaphis graminum High-affinity zinc uptake system membrane protein znuB (znuB)

This Recombinant Buchnera aphidicola subsp. Schizaphis graminum High-affinity zinc uptake system membrane protein znuB (znuB) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

High-affinity zinc uptake system membrane protein znuB

UniProt

Q8K9M7

Expression Region

1-261

Origin

Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFELIYPGWLAGILLSFATGPLGSFIIWRRISSFGDTLSHSSILGLAISILFQIDSFYTE LFFMSFLAIILVWMEQLLSVSLETILSIISHSSLSLGIICISLMSTSHHIDLSNYLFGDL LLVTVFDLCIIALGSLIVLTILFFRWNSILLLTVNEELAQIDGVNIFYARLTLMLTTAIC ISIAIKFVGVLLITSLLIIPPATAQIFSNSPEKTIGFSILISIISVTGGIFLSFFYNVPT SPSIVLFSSCVYLLSNIKKLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-500 1x 500 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
BNC681081-100 1x 100 µL

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (MYD712), CF488A conjugate, 0.1mg/mL
BNC880712-500 1x 500 µL

MyoD1 (MYD712), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF405S conjugate, 0.1mg/mL
BNC041825-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), 1mg/mL
BNUM1429-50 1x 50 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), 1mg/mL

Sign In for Pricing
View Details