Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus halodurans Cobalamin synthase (cobS)

This Recombinant Bacillus halodurans Cobalamin synthase (cobS) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q9KCH9

Expression Region

1-261

Origin

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKHGLNGLLLAFQFLTTVPITRQIPWTARSARWSIVCYPLTGLVLGGLLVSLYLLLSPFL SPLVLAALLVTLSIFYSGGLHLDGWMDVSDAFLSRRDRETKLIILKDSRVGAFAVMTTIL LIGWKVLLLMELIALAPREFTWLLLLVPVCLRWMIIVQLIYGKAASDQGMAASLLPYVTT HVKNASRVWFLFIAGACFLLLQNVILTLCFLLMIWLFPLFWLRVCKREIGGMSGDTIGAS IEGGELFLWGIMWTFFLSVTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Alanyl-L-glutamine (Ala-Gln)
orb1301662-01 10 g

L-Alanyl-L-glutamine (Ala-Gln)

Sign In for Pricing
View Details
L-Alanyl-L-glutamine (Ala-Gln)
orb1301662-02 50 g

L-Alanyl-L-glutamine (Ala-Gln)

Sign In for Pricing
View Details
AKT2, ID (RAC-beta Serine/Threonine-protein Kinase, RAC-PK-beta, Protein Kinase Akt-2, Protein Kinase B, beta, PKB beta) (MaxLight 650) discontinued
A1125-26L-ML650 100 µL

AKT2, ID (RAC-beta Serine/Threonine-protein Kinase, RAC-PK-beta, Protein Kinase Akt-2, Protein Kinase B, beta, PKB beta) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Glycocholic Acid Dimer Impurity 16
RM-G121516-01 10 mg

Glycocholic Acid Dimer Impurity 16

Sign In for Pricing
View Details
Glycocholic Acid Dimer Impurity 16
RM-G121516-02 25 mg

Glycocholic Acid Dimer Impurity 16

Sign In for Pricing
View Details
Glycocholic Acid Dimer Impurity 16
RM-G121516-03 50 mg

Glycocholic Acid Dimer Impurity 16

Sign In for Pricing
View Details