Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus halodurans Cobalamin synthase (cobS)

This Recombinant Bacillus halodurans Cobalamin synthase (cobS) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q9KCH9

Expression Region

1-261

Origin

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKHGLNGLLLAFQFLTTVPITRQIPWTARSARWSIVCYPLTGLVLGGLLVSLYLLLSPFL SPLVLAALLVTLSIFYSGGLHLDGWMDVSDAFLSRRDRETKLIILKDSRVGAFAVMTTIL LIGWKVLLLMELIALAPREFTWLLLLVPVCLRWMIIVQLIYGKAASDQGMAASLLPYVTT HVKNASRVWFLFIAGACFLLLQNVILTLCFLLMIWLFPLFWLRVCKREIGGMSGDTIGAS IEGGELFLWGIMWTFFLSVTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GGT2 Rabbit Polyclonal Antibody
JOT-AP10160-01 20 µL

GGT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GGT2 Rabbit Polyclonal Antibody
JOT-AP10160-02 50 μL

GGT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GGT2 Rabbit Polyclonal Antibody
JOT-AP10160-03 100 µL

GGT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Acetyltyramine
BA1360-5.1 1 mL (10 mM in DMSO)

N-Acetyltyramine

Sign In for Pricing
View Details
Stabilin 2 Rabbit Polyclonal Antibody (Biotin)
orb448628 100 µL

Stabilin 2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human Parkinson Disease Protein 2 (PARK2) ELISA Kit
MBS2024323-01 24 Strip Well

Human Parkinson Disease Protein 2 (PARK2) ELISA Kit

Sign In for Pricing
View Details