Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q9PCE0

Expression Region

1-261

Origin

Xylella fastidiosa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFELFTALMLGILEGITEFLPVSSTGHLLIAEHWLGSRSDFFNIVIQAGAILAITFVFRK RVWSLATGLDKYSNRDYVMKLATAFLITAVVGLAVRKANWQLPETIQPIAWALIIGGIWI LIAESVAKHLPERENVTWSVAIAVGLAQVVAGVFPGTSRSASTIFLAMLLGLSKRSAAAE FSFLVGIPTMFSASSYACFELFKRGELLHENWLEVSVAFVAAMLTGFAVVKWLLGYIKNH SFAPFAYYRIALGLVLLTWLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EAAT1 SLC1A3 Rabbit Monoclonal Antibody
orb547958 100 µL

EAAT1 SLC1A3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD286/TLR6 Protein, N-His
orb2834672-01 20 µg

Recombinant Human CD286/TLR6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD286/TLR6 Protein, N-His
orb2834672-02 50 µg

Recombinant Human CD286/TLR6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD286/TLR6 Protein, N-His
orb2834672-03 100 µg

Recombinant Human CD286/TLR6 Protein, N-His

Sign In for Pricing
View Details
LXN mouse monoclonal antibody
orb2327786-01 25 µL

LXN mouse monoclonal antibody

Sign In for Pricing
View Details
LXN mouse monoclonal antibody
orb2327786-02 100 µL

LXN mouse monoclonal antibody

Sign In for Pricing
View Details