Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Pan troglodytes Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, Cytochrome c oxidase polypeptide III

UniProt

Q9T9V9

Expression Region

1-261

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFYSTTLLTLGLLTNTLTMYQWWRD VMREGTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTG ITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASE YFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICLIRQLMFHFTSKHHFGFQAAAW YWHFVDVVWLFLYVSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit
E-MSEL-M0062-01 24 Tests

Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit
E-MSEL-M0062-02 48 Tests

Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit
E-MSEL-M0062-03 96 Tests

Mini Sample Mouse F9 (Coagulation Factor IX) ELISA Kit

Sign In for Pricing
View Details
CAB39L Human Gene Knockout Kit (CRISPR)
KN203394LP 1 Kit

CAB39L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS631287 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
FAM13C Antibody
KC-3603-01 50 μL

FAM13C Antibody

Sign In for Pricing
View Details