Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan paniscus Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Pan paniscus Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, Cytochrome c oxidase polypeptide III

UniProt

Q9T9W8

Expression Region

1-261

Origin

Pan paniscus (Pygmy chimpanzee) (Bonobo)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFYSTTLLTLGLLTNTLTMYQWWRD VMRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTG ITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASE YFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICLIRQLMFHFTSKHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Nitrosodiisopropylamine- d14
TRC-N525602-50MG 50 mg

N-Nitrosodiisopropylamine- d14

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD565315 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
Mouse Tmem59 activation kit by CRISPRa
GA205931 1 Kit

Mouse Tmem59 activation kit by CRISPRa

Sign In for Pricing
View Details
KIAA0323 (KHNYN) Human Gene Knockout Kit (CRISPR)
KN206738BN 1 Kit

KIAA0323 (KHNYN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CDK10 Human Gene Knockout Kit (CRISPR)
KN413705 1 Kit

CDK10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human PRTN3 Protein (His Tag)
PDMH100183-01 20 µg

Recombinant Human PRTN3 Protein (His Tag)

Sign In for Pricing
View Details