Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Gorilla gorilla gorilla Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, Cytochrome c oxidase polypeptide III

UniProt

Q9T9Y6

Expression Region

1-261

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSTTLLMLGLLTNMLTMYQWWRD VMRESTYQGHHTLPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGAHWPPTG ITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASE YFEAPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICLIRQLMFHFTSKHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-14-3-3 epsilon Antibody (9D754)
TMAY-01250 100 µL

Anti-14-3-3 epsilon Antibody (9D754)

Sign In for Pricing
View Details
Endo G Rabbit pAb, IRDye 800CW conjugated
orb2870483 100 µL

Endo G Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Mouse Hepc ELISA Kit
orb440024-01 48 Tests

Mouse Hepc ELISA Kit

Sign In for Pricing
View Details
Mouse Hepc ELISA Kit
orb440024-02 96 Tests

Mouse Hepc ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Parathyroid hormone 2 receptor Protein, His-SUMO, E.coli-100ug
QP6552-ec-100ug 100ug

Recombinant Human Parathyroid hormone 2 receptor Protein, His-SUMO, E.coli-100ug

Sign In for Pricing
View Details
H3F3B (H3.3B) discontinued
510105 100 µg

H3F3B (H3.3B) discontinued

Sign In for Pricing
View Details