Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Gorilla gorilla gorilla Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, Cytochrome c oxidase polypeptide III

UniProt

Q9T9Y6

Expression Region

1-261

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSTTLLMLGLLTNMLTMYQWWRD VMRESTYQGHHTLPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGAHWPPTG ITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASE YFEAPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICLIRQLMFHFTSKHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAT-20-619-10 Tractor-fed Labels for Printers
028973 10000 Pack (10000 Label (s) x 1 Pack)

DAT-20-619-10 Tractor-fed Labels for Printers

Sign In for Pricing
View Details
hsa-miR-6755-5p miRNA Mimic
MCH03464 2x 2.5 nmol

hsa-miR-6755-5p miRNA Mimic

Sign In for Pricing
View Details
Recombinant Natronomonas pharaonis Tyrosine--tRNA ligase (tyrS)
MBS1449430-01 0.02 mg (E-Coli)

Recombinant Natronomonas pharaonis Tyrosine--tRNA ligase (tyrS)

Sign In for Pricing
View Details
Recombinant Natronomonas pharaonis Tyrosine--tRNA ligase (tyrS)
MBS1449430-02 0.02 mg (Yeast)

Recombinant Natronomonas pharaonis Tyrosine--tRNA ligase (tyrS)

Sign In for Pricing
View Details
Recombinant Natronomonas pharaonis Tyrosine--tRNA ligase (tyrS)
MBS1449430-03 0.1 mg (E-Coli)

Recombinant Natronomonas pharaonis Tyrosine--tRNA ligase (tyrS)

Sign In for Pricing
View Details
Recombinant Natronomonas pharaonis Tyrosine--tRNA ligase (tyrS)
MBS1449430-04 0.1 mg (Yeast)

Recombinant Natronomonas pharaonis Tyrosine--tRNA ligase (tyrS)

Sign In for Pricing
View Details