Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Gorilla gorilla gorilla Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, Cytochrome c oxidase polypeptide III

UniProt

Q9T9Y6

Expression Region

1-261

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSTTLLMLGLLTNMLTMYQWWRD VMRESTYQGHHTLPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGAHWPPTG ITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASE YFEAPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICLIRQLMFHFTSKHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Telitacicept Biosimilar - Research Grade
ICH5911-1mg 1 mg

Telitacicept Biosimilar - Research Grade

Sign In for Pricing
View Details
MANSC4 siRNA (Human)
CRJ8863-01 15 nmol

MANSC4 siRNA (Human)

Sign In for Pricing
View Details
MANSC4 siRNA (Human)
CRJ8863-02 30 nmol

MANSC4 siRNA (Human)

Sign In for Pricing
View Details
RSAD2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
42766126 3x 1.0µg DNA

RSAD2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Human TNPO2 Knockout HEK293T cell line
GTR15411192 1 Vial

Human TNPO2 Knockout HEK293T cell line

Sign In for Pricing
View Details
NLRP3P CRISPR Knock Out 293T Cell Line (Human)
31917141 1x 10^6 Cells / 1.0 mL

NLRP3P CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details