Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oncorhynchus nerka Cytochrome c oxidase subunit 3 (mt-co3)

This Recombinant Oncorhynchus nerka Cytochrome c oxidase subunit 3 (mt-co3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

P69218

Expression Region

1-261

Origin

Oncorhynchus nerka (Sockeye salmon) (Salmo nerka)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHQAHAYHMVDPSPWPLTGAIAALLLTSGTAVWFHFHSLTLLTLGNVLLLLTMYQWWRD IIREGTFQGHHTPPVQKGLRYGMILFITSEVFFFLGFFWAFYHASLAPTPELGGCWPPTG ITTLDPFEVPLLNTAVLLASGVTVTWAHHSIMEGERKQTIQALTLTILLGFYFTFLQGME YYEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQVQYHFTSEHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-500 1x 500 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-100 1x 100 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
BNC470669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL
BNC940994-100 1x 100 µL

TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), CF594 conjugate, 0.1mg/mL
BNC940612-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF594 conjugate, 0.1mg/mL
BNC942400-500 1x 500 µL

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details