Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome c oxidase subunit 3 (Mtco3)

This Recombinant Mouse Cytochrome c oxidase subunit 3 (Mtco3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, Cytochrome c oxidase polypeptide III

UniProt

P00416

Expression Region

1-261

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRD VIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLVPTHDLGGCWPPTG ISPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGKRNHMNQALLITIMLGLYFTILQASE YFETSFSISDGIYGSTFFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAW YWHFVDVIWLFLYVSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arrdc1 Mouse Gene Knockout Kit (CRISPR)
KN501618 1 Kit

Arrdc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Sectm1b activation kit by CRISPRa
GA206267 1 Kit

Mouse Sectm1b activation kit by CRISPRa

Sign In for Pricing
View Details
PAMM (FAM213A) Rabbit Polyclonal Antibody
TA368286 100 µL

PAMM (FAM213A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MORC3 (NM_015358) Human Recombinant Protein
TP310530 20 µg

MORC3 (NM_015358) Human Recombinant Protein

Sign In for Pricing
View Details
16S V3-V5 Library Preparation Kit for Illumina (Set C)
70530 96 Preparations

16S V3-V5 Library Preparation Kit for Illumina (Set C)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: left upper lobe
CS640413 5x 5 µm

Frozen Tissue Sections, Lung: left upper lobe

Sign In for Pricing
View Details