Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome c oxidase subunit 3 (Mtco3)

This Recombinant Mouse Cytochrome c oxidase subunit 3 (Mtco3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, Cytochrome c oxidase polypeptide III

UniProt

P00416

Expression Region

1-261

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRD VIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLVPTHDLGGCWPPTG ISPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGKRNHMNQALLITIMLGLYFTILQASE YFETSFSISDGIYGSTFFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAW YWHFVDVIWLFLYVSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP1 Mouse Monoclonal Antibody [Clone ID: OTI6H10]
CF808606 100 µg

IGFBP1 Mouse Monoclonal Antibody [Clone ID: OTI6H10]

Sign In for Pricing
View Details
Milk Fat Globulin (EDM45), 0.2mg/mL
BNUB0942-500 1x 500 µL

Milk Fat Globulin (EDM45), 0.2mg/mL

Sign In for Pricing
View Details
D-Valinamide hydrochloride
TRC-V094050-1G 1 g

D-Valinamide hydrochloride

Sign In for Pricing
View Details
CPT2 Recombinant Rabbit monoclonal Antibody
HA750265 100 µL

CPT2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121UT3-01 25 µg

Elab Fluor® Violet 540 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121UT3-02 100 µg

Elab Fluor® Violet 540 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details