Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sphingomonas wittichii ATP synthase subunit a (atpB)

This Recombinant Sphingomonas wittichii ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5VEV5

Expression Region

1-261

Origin

Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAESGKIDPMHQFMIEPLFGQGWSIAGHNIAFTNSAMWMVVTLAALLIFMIGGMKRDLV PGRWQAAVESFTGFVAGMMATNIGPEGKKFTPYVFSLFMFILIANIMGMMPTGVVGVHPF TVTSHLTVTGVLAVISFSIVLVVGFWRHGFHFFSLFVPHGTPGYMIPMIFVIELFSFLIR PFSLGLRLFVAMTAGHILMKVLAGFVINGINAGALTVAIVSIPSFILMIGITLLELLVCA IQAYVFALLTSLYLNDAINLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human kappa, AlpSdAbs® VHH (Biotin)
HA710183 100 µg

Human kappa, AlpSdAbs® VHH (Biotin)

Sign In for Pricing
View Details
Mouse Ccl22 activation kit by CRISPRa
GA203801 1 Kit

Mouse Ccl22 activation kit by CRISPRa

Sign In for Pricing
View Details
Goat anti-Rabbit IgG Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS
MTB26F4-aR 10x 96 Well Plates

Goat anti-Rabbit IgG Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS

Sign In for Pricing
View Details
Hydroxypropanedial
TRC-H952475-25MG 25 mg

Hydroxypropanedial

Sign In for Pricing
View Details
Human Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP) ELISA Kit
RD-TIRAP-Hu-01 96 Tests

Human Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP) ELISA Kit

Sign In for Pricing
View Details
Human Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP) ELISA Kit
RD-TIRAP-Hu-02 48 Tests

Human Toll Interleukin 1 Receptor Domain Containing Adaptor Protein (TIRAP) ELISA Kit

Sign In for Pricing
View Details