Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tragelaphus scriptus Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Tragelaphus scriptus Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, Cytochrome c oxidase polypeptide III

UniProt

O47687

Expression Region

1-261

Origin

Tragelaphus scriptus (Bushbuck)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMILLMLGLTTNMLTMYQWWRD IIRESTFQGHHTPVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTG IHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGHRNHMLQALFITIALGVYFTLLQASE YYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYKDDDDK Epitope Tag Mouse Monoclonal Antibody [Clone ID: 2F11G1]
AM06227SU-N 100 µL

DYKDDDDK Epitope Tag Mouse Monoclonal Antibody [Clone ID: 2F11G1]

Sign In for Pricing
View Details
Guanosine 3’,5’-Cyclic Monophosphate Sodium Salt
TRC-G837960-10MG 10 mg

Guanosine 3’,5’-Cyclic Monophosphate Sodium Salt

Sign In for Pricing
View Details
Mouse CD86 Recombinant Rabbit monoclonal Antibody
HA723553 100 µL

Mouse CD86 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: peripheral
CS630286 5x 5 µm

Frozen Tissue Sections, Artery: peripheral

Sign In for Pricing
View Details
6-(2-Chlorophenyl)-2,4-dihydro-8-nitro-1H-imidazo[1,2-a][1,4]benzodiazepin-1-one
TRC-C609885-25MG 25 mg

6-(2-Chlorophenyl)-2,4-dihydro-8-nitro-1H-imidazo[1,2-a][1,4]benzodiazepin-1-one

Sign In for Pricing
View Details
Tiam2 Mouse Gene Knockout Kit (CRISPR)
KN517556 1 Kit

Tiam2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details