Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum High-affinity zinc uptake system membrane protein znuB (znuB)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum High-affinity zinc uptake system membrane protein znuB (znuB) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

High-affinity zinc uptake system membrane protein znuB

UniProt

P57402

Expression Region

1-262

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFELIFPGWLAGVLLSLTTGPLGSFIVWRRMSSFGDTLSHSSLLGIALSIAFNINSFYAI LILMSFIAIILAWLEELLPVSLDTVLNIISHSSLSLGMVFISLISSKKEINITNYLFGDL LSVTKNDLITISISSILILSILLFRWHSILSSTINEELSQIDGINVLYARLTIMLMTAFT IAIAIKFVGALLITSLLIIPPATAQHFSGSPEKMVIIAIIVSILSVTGGISLSVFYNTPA SPSIVLCSSFLCLISNIKKHFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-500 1x 500 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-500 1x 500 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-100 1x 100 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL
BNC040669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF640R conjugate, 0.1mg/mL
BNC402968-500 1x 500 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details