Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit C (mtrC)

This Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit C (mtrC) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit C, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit C

UniProt

A4FVW3

Expression Region

1-262

Origin

Methanococcus maripaludis (strain C5 / ATCC BAA-1333)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHGGGGHAAELFPEDQVLAFGAVLSLVGIYIAHFFPSLAMLLGGLLAAGACVAGANTTR RVAAYGLGTGVPSIGMVSLGMGTISALAGVLIPSAFGLPVLVTPILAAVIAVVVGFIVGK LTQNPVGMKVPIIVSSMTKLSLMGALAILGFCTAFAGGFSADIIINGAINNGVIALAFIA AGMAILHPFNACIGPDESHKRTMTLAVACGFMAWLVFAIAKLDIVSTAVAAIFWFIAYGT FVKTSLADACEVKYVPELPKKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Vmn2r7 shRNA (UAS) - Lentiviral mouse Vmn2r7 shRNA (UAS, iRFP) (100)
GTR15119223 1 Vial

Lentiviral mouse Vmn2r7 shRNA (UAS) - Lentiviral mouse Vmn2r7 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Heptadecanoyl Chloride
451757-01 100 mg

Heptadecanoyl Chloride

Sign In for Pricing
View Details
Heptadecanoyl Chloride
451757-02 250 mg

Heptadecanoyl Chloride

Sign In for Pricing
View Details
DYNC1LI2 antibody
FNab02586 100 µg

DYNC1LI2 antibody

Sign In for Pricing
View Details
Recombinant Chloroherpeton thalassium DNA mismatch repair protein mutL (mutL), partial
MBS1013456 Inquire

Recombinant Chloroherpeton thalassium DNA mismatch repair protein mutL (mutL), partial

Sign In for Pricing
View Details
P130 Cas (Ab-410) Antibody
orb193037-01 50 μL

P130 Cas (Ab-410) Antibody

Sign In for Pricing
View Details