Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Streptococcus pneumoniae Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

C1CF00

Expression Region

1-262

Origin

Streptococcus pneumoniae (strain JJA)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDPIAIQLGPLAIRWYALCIVTGLILAVYLTMKEAPRKKIIPDDILDFILVAFPLAILG ARLYYVIFRFDYYSQNLGEIFAIWNGGLAIYGGLITGALVLYIFADRKLINTWDFLDIAA PSVMIAQSLGRWGNFFNQEAYGATVDNLDYLPGFIRDQMYIEGSYRQPTFLYESLWNLLG FALILIFRRKWKSLRRGHITAFYLIWYGFGRMVIEGMRTDSLMFFSLRVSQWLSVVLIGL GIMIVIYQNRKKAPYYITEEEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
BNC470679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-500 1x 500 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
BNC882216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-100 1x 100 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carbonic Anhydrase IX (CA9/781), CF568 conjugate, 0.1mg/mL
BNC680781-100 1x 100 µL

Carbonic Anhydrase IX (CA9/781), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1892), CF594 conjugate, 0.1mg/mL
BNC941892-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1892), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details