Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti Nodulation protein J (nodJ)

This Recombinant Rhizobium meliloti Nodulation protein J (nodJ) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nodulation protein J

UniProt

O52619

Expression Region

1-262

Origin

Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWKLYVAALPANGWNWIAVWRRNYLAWKKVALASILGNLADPLIYLFGLGAGLGMMVGRV DGVSYIAFLSAGMVATSAMTASTFETIYATFARMRAQRTWEAILHTQVTIGDIVLGELAW AATKASLAGTGIGVVAATLGYTEWVSLLYALPVIALTGLAFASLAMIVTALAPSYEYFIF YQTLVITPMLFLSGAVFPVNQLPGAFQHVTRILPLAHSIDVIRPIMLGSPLVHVGLHIGA LCCYAVVPFFLSTALLRRRLMP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-500 1x 500 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (4C4.9 + S100B/1012), 0.2mg/mL
BNC041204-100 1x 100 µL

S100B (4C4.9 + S100B/1012), 0.2mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (34BE12), CF568 conjugate, 0.1mg/mL
BNC680446-100 1x 100 µL

Cytokeratin, HMW (34BE12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/718), CF568 conjugate, 0.1mg/mL
BNC680718-500 1x 500 µL

HER-2 / CD340 (HRB2/718), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details