Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q37620

Expression Region

1-262

Origin

Prototheca wickerhamii

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRKHPFHLVDPSPWPLLASFAAFLSTTGGVMYMHAYSGGGLLLAIGQLSLFYVMYVWWRD VIREGTYQGHHTNPVQVGLRYGMLLFILSEIMFFFAFFWAFFHSSLAPTIEIGAVWPPKG IQVLNPWEIPFLNTIILLTSGASVTWAHHAILAGNRKQGIISLAITVLLAVIFTGFQALE YLEAPFTISDGIYGSTFYLATGFHGFHVIIGTIFIAVCLFRLVLHHFSKSHHLGFEAAAW YWHMVDVVWLFLFVCIYYWGGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELOB (N-term) Rabbit Polyclonal Antibody
AP54200PU-N 400 µL

ELOB (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SHISAL2A activation kit by CRISPRa
GA117681 1 Kit

Human SHISAL2A activation kit by CRISPRa

Sign In for Pricing
View Details
Erythropoietin (EPO) (Marker of Placentation Disorders) (rEPO/1367), CF740 conjugate, 0.1mg/mL
BNC743792-500 1x 500 µL

Erythropoietin (EPO) (Marker of Placentation Disorders) (rEPO/1367), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
[2,2'-Bis(diphenylphosphino)-1,1'-binaphthalene]chloro(p-cymene)ruthenium Chloride
TRC-B430395-250MG 250 mg

[2,2'-Bis(diphenylphosphino)-1,1'-binaphthalene]chloro(p-cymene)ruthenium Chloride

Sign In for Pricing
View Details
Cab39l Mouse Gene Knockout Kit (CRISPR)
KN502400 1 Kit

Cab39l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2'-Amino-2-biphenylsulfonic Acid Sultam
TRC-A474893-25MG 25 mg

2'-Amino-2-biphenylsulfonic Acid Sultam

Sign In for Pricing
View Details