Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q37620

Expression Region

1-262

Origin

Prototheca wickerhamii

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRKHPFHLVDPSPWPLLASFAAFLSTTGGVMYMHAYSGGGLLLAIGQLSLFYVMYVWWRD VIREGTYQGHHTNPVQVGLRYGMLLFILSEIMFFFAFFWAFFHSSLAPTIEIGAVWPPKG IQVLNPWEIPFLNTIILLTSGASVTWAHHAILAGNRKQGIISLAITVLLAVIFTGFQALE YLEAPFTISDGIYGSTFYLATGFHGFHVIIGTIFIAVCLFRLVLHHFSKSHHLGFEAAAW YWHMVDVVWLFLFVCIYYWGGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 610 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842T-01 20 Tests

Elab Fluor® Violet 610 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842T-02 100 Tests

Elab Fluor® Violet 610 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842T-03 2x 100 Tests

Elab Fluor® Violet 610 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
1alpha,25-Dihydroxy-23-oxovitamin-d3
TRC-H563771-25MG 25 mg

1alpha,25-Dihydroxy-23-oxovitamin-d3

Sign In for Pricing
View Details
2-(O-DMT)-6-(Retinamide)-1-hexanol (>85%)
TRC-B213300-500MG 500 mg

2-(O-DMT)-6-(Retinamide)-1-hexanol (>85%)

Sign In for Pricing
View Details
Human CD62E (SELE) activation kit by CRISPRa
GA104354 1 Kit

Human CD62E (SELE) activation kit by CRISPRa

Sign In for Pricing
View Details