Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L211 (MIMI_L211)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L211 (MIMI_L211) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Uncharacterized protein L211

UniProt

Q5UQ30

Expression Region

1-262

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHISLNICKDIFCGFFDSVRIDIAIKKLYNDQKLQKKIIKIAKFNTIMYLVPYIITYTV LNTFDYDLFSIINIVYLFVNVISGLFHLLYFIDLIDIVCVYTKKLNRPISKLDSIGLAIV SFVYQLSMYIIMELIDMMLYKKLDVVSYLIKFIILTLYHSFCCFNNLWHYKNIDIHHRIS LHEKLWAYYLGYGTIASLMYIYSNHPLMIYTYNIYMSILIILPFMIKTKYPKKQAYPSIN LKIFSIIVGYFNYAIKLINNSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLAA (HLA-A) Rabbit Polyclonal Antibody
TA377096 100 µL

HLAA (HLA-A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), Biotin conjugate, 0.1mg/mL
BNCB1950-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GDF15 Polyclonal Antibody
E-AB-40583-01 25 µL

GDF15 Polyclonal Antibody

Sign In for Pricing
View Details
GDF15 Polyclonal Antibody
E-AB-40583-02 100 µL

GDF15 Polyclonal Antibody

Sign In for Pricing
View Details
TIPIN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E6]
TA802939AM 100 µL

TIPIN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E6]

Sign In for Pricing
View Details
CD22 Mouse Monoclonal Antibody [Clone ID: OTI8E6]
CF807844 100 µg

CD22 Mouse Monoclonal Antibody [Clone ID: OTI8E6]

Sign In for Pricing
View Details