Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L211 (MIMI_L211)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L211 (MIMI_L211) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Uncharacterized protein L211

UniProt

Q5UQ30

Expression Region

1-262

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHISLNICKDIFCGFFDSVRIDIAIKKLYNDQKLQKKIIKIAKFNTIMYLVPYIITYTV LNTFDYDLFSIINIVYLFVNVISGLFHLLYFIDLIDIVCVYTKKLNRPISKLDSIGLAIV SFVYQLSMYIIMELIDMMLYKKLDVVSYLIKFIILTLYHSFCCFNNLWHYKNIDIHHRIS LHEKLWAYYLGYGTIASLMYIYSNHPLMIYTYNIYMSILIILPFMIKTKYPKKQAYPSIN LKIFSIIVGYFNYAIKLINNSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttll2 Mouse Gene Knockout Kit (CRISPR)
KN518443 1 Kit

Ttll2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Crkl activation kit by CRISPRa
GA200878 1 Kit

Mouse Crkl activation kit by CRISPRa

Sign In for Pricing
View Details
APC Anti-Mouse Foxp3 Antibody[3G3]
E-AB-F1238E-01 50 Tests

APC Anti-Mouse Foxp3 Antibody[3G3]

Sign In for Pricing
View Details
APC Anti-Mouse Foxp3 Antibody[3G3]
E-AB-F1238E-02 100 Tests

APC Anti-Mouse Foxp3 Antibody[3G3]

Sign In for Pricing
View Details
APC Anti-Mouse Foxp3 Antibody[3G3]
E-AB-F1238E-03 2x 100 Tests

APC Anti-Mouse Foxp3 Antibody[3G3]

Sign In for Pricing
View Details
OR1M1 Human Gene Knockout Kit (CRISPR)
KN416998 1 Kit

OR1M1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details